1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His)

Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71806
Handling Instructions Technical Support

Gamma-hemolysin component B (HLgB) acts as a toxin, creating cell membrane pores with hemolytic and leukotoxic activities. Furthermore, HLgB promotes AMFR-mediated inflammation by promoting “Lys-27” linked ubiquitination of TAB3, mediating TAK1-TAB3 complex formation, and activating NF-kappa-B signaling. Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Gamma-hemolysin component B protein, expressed by P. pastoris , with N-His labeled tag. The total length of Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) is 300 a.a., with molecular weight of ~36.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Gamma-hemolysin component B (HLgB) acts as a toxin, creating cell membrane pores with hemolytic and leukotoxic activities. Furthermore, HLgB promotes AMFR-mediated inflammation by promoting “Lys-27” linked ubiquitination of TAB3, mediating TAK1-TAB3 complex formation, and activating NF-kappa-B signaling. Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Gamma-hemolysin component B protein, expressed by P. pastoris , with N-His labeled tag. The total length of Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) is 300 a.a., with molecular weight of ~36.1 kDa.

Background

Gamma-hemolysin component B (HlgB) functions as a toxin, exerting its effects by forming pores in the cell membrane and displaying hemolytic and leucotoxic activities. Additionally, HlgB plays a role in promoting host AMFR-mediated inflammation by facilitating 'Lys-27'-linked ubiquitination of TAB3, mediating TAK1-TAB3 complex formation, and phosphorylating TAK1/MAP3K7, thereby activating the host NF-kappa-B signaling pathway. The toxicity of HlgB relies on the sequential binding and synergistic association of a class S and a class F component, leading to the formation of heterooligomeric complexes. Specifically, HlgB (class F) associates either with HlgA, forming an AB toxin, or with HlgC, forming a CB toxin. These interactions and activities underscore the multifaceted nature of HlgB in cellular processes and host-pathogen interactions.

Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-His

Accession

P0A075 (A26-K325)

Gene ID

59701249

Molecular Construction
N-term
His
hlgB (A26-K325)
Accession # P0A075
C-term
Synonyms
hlgB; SA2209; Gamma-hemolysin component B; H-gamma-1; H-gamma-I
AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Molecular Weight

Approximately 36.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71806
Quantity:
MCE Japan Authorized Agent: