1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β1
  6. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)

GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P77675
SDS COA Handling Instructions Technical Support

LRRC32, a key regulator of TGF-beta activation, maintains TGFB1, TGFB2, and TGFB3 in a latent state during extracellular storage by binding to Latency-associated peptide (LAP). Competing with LTBP1 for LAP binding, LRRC32 effectively modulates integrin-dependent TGF-beta activation. Its significance spans the regulation of TGF-beta-1 (TGFB1) on activated Tregs' surface and the control of TGF-beta-3 (TGFB3) during palate development, emphasizing LRRC32's intricate role in fine-tuning TGF-beta signaling. Interactions with TGFB1, TGFB2, TGFB3, and LAPTM4B contribute to its regulatory functions. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293, with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LRRC32, a key regulator of TGF-beta activation, maintains TGFB1, TGFB2, and TGFB3 in a latent state during extracellular storage by binding to Latency-associated peptide (LAP). Competing with LTBP1 for LAP binding, LRRC32 effectively modulates integrin-dependent TGF-beta activation. Its significance spans the regulation of TGF-beta-1 (TGFB1) on activated Tregs' surface and the control of TGF-beta-3 (TGFB3) during palate development, emphasizing LRRC32's intricate role in fine-tuning TGF-beta signaling. Interactions with TGFB1, TGFB2, TGFB3, and LAPTM4B contribute to its regulatory functions. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant protein dimer complex containing human-derived GARP&Latent TGF beta Complex protein, expressed by HEK293, with C-Avi, C-His labeled tag. GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi), has molecular weight of (73-78) kDa (GARP) & 13 kDa & (42-45) kDa (Latent TGF beta 1), respectively.

Background

LRRC32, a crucial regulator of transforming growth factor beta (TGFB1, TGFB2, and TGFB3), plays a pivotal role in controlling TGF-beta activation by maintaining it in a latent state during extracellular storage. Specifically associating with the Latency-associated peptide (LAP), the regulatory chain of TGF-beta, LRRC32 exerts its regulatory influence on integrin-dependent TGF-beta activation. Notably, LRRC32 competes effectively with LTBP1 for LAP binding, further modulating TGF-beta activation. Its significance extends to the regulation of TGF-beta-1 (TGFB1) activation on the surface of activated regulatory T-cells (Tregs). Moreover, LRRC32's involvement is essential for epithelial fusion during palate development, where it regulates the activation of TGF-beta-3 (TGFB3). Interacting directly with TGFB1, TGFB2, and TGFB3, LRRC32's association with LAP regulates the activation of TGF-beta-1 and TGF-beta-3, highlighting its intricate role in fine-tuning TGF-beta signaling. Additionally, LRRC32 interacts with LAPTM4B, contributing to the reduction of TGFB1 production in regulatory T-cells.

Biological Activity

Immobilized Biotinylated Human GARP&Latent TGF beta Complex at 5 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-GARP&TGF beta Antibody with the EC50 of 44-45.8 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

Q14392 (H20-L628,GARP)&P01137 (L30-S390,Latent TGF bata 1)

Gene ID

2615  [NCBI]&7040  [NCBI]

Synonyms
LRRC32; GARP; LAP; TGF-beta-1; LRRC32&TGF-beta 1; LRRC32&TGFB1
AA Sequence

HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINL&LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

(73-78) kDa (GARP)&13 kDa&(42-45) kDa (Latent TGF beta 1)

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GARP&Latent TGF beta Complex Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P77675
Quantity:
MCE Japan Authorized Agent: