Gastrin-71 Protein, Mouse (HEK293, Fc)

Gastrin-71 protein acts as a potent stimulator of various physiological processes. It activates the gastric mucosa, promotes the production and secretion of hydrochloric acid, and induces the release of digestive enzymes from the pancreas. Gastrin-71 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Gastrin-71 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Gastrin-71 Protein, Mouse (HEK293, Fc) is 71 a.a., with molecular weight of approximately 38-43 kDa.

Gastrin-71 is a peptide hormone belonging to the gastrin family, playing a vital role in the regulation of gastrointestinal functions. Known for its stimulatory effects, gastrin prompts the stomach mucosa to produce and secrete hydrochloric acid, essential for the digestion of food. Additionally, it influences the pancreas, triggering the secretion of digestive enzymes crucial for nutrient breakdown. Gastrin-71 further contributes to gastrointestinal dynamics by stimulating smooth muscle contraction, enhancing blood circulation, and increasing water secretion in both the stomach and intestine. These multifaceted actions highlight the importance of Gastrin-71 in orchestrating various physiological processes crucial for efficient digestion and nutrient absorption.

Measured in a cell proliferation assay using HT-29 human coloncancer cells.The ED₅₀ for this effect is 1.093 ng/mL, corresponding to a specificactivity is 9.15×10⁵ Unit/mg.

• 
  Measured in a cell proliferation assay using HT-29 human coloncancer cells.The ED₅₀ for this effect is 1.093 ng/mL, corresponding to a specificactivity is 9.15×10⁵ Unit/mg.

Mouse

HEK293

C-hFc

P48757 (S22-F92)

14459  [NCBI]

SWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDF

approximately 38-43 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM arginine, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.