1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Glucagon Receptor
  5. GCGR Protein, Human (HEK293, N-His, C-Myc)

The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GCGR protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GCGR Protein, Human (HEK293, N-His, C-Myc) is 111 a.a., with molecular weight of ~35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GCGR protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GCGR Protein, Human (HEK293, N-His, C-Myc) is 111 a.a., with molecular weight of ~35 kDa.

Background

The GCGR Protein serves as a G-protein coupled receptor for glucagon, playing a pivotal role in the regulation of blood glucose levels and glucose homeostasis. It actively regulates hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, making it a key mediator of responses to fasting. Upon ligand binding, the receptor undergoes a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins), subsequently modulating downstream effectors such as adenylate cyclase. This modulation results in the activation of adenylate cyclase. Furthermore, the receptor contributes to signaling via a phosphatidylinositol-calcium second messenger system, underscoring its multifaceted role in glucose regulation.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC50 is <6.666 ng/mL.

Species

Human

Source

HEK293

Tag

C-Myc;N-10*His

Accession

P47871 (A26-K136)

Gene ID
Molecular Construction
N-term
10*His-Myc
GCGR (A26-K136)
Accession # P47871
C-term
Synonyms
glucagon receptor; GGR; GL-R; FLJ97182; MGC138246;
AA Sequence

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Molecular Weight

Approximately 35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GCGR Protein, Human (HEK293, N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GCGR Protein, Human (HEK293, N-His, C-Myc)
Cat. No.:
HY-P700411
Quantity:
MCE Japan Authorized Agent: