GCGR Protein, Human (HEK293, N-His, C-Myc)

The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GCGR protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag. The total length of GCGR Protein, Human (HEK293, N-His, C-Myc) is 111 a.a., with molecular weight of ~35 kDa.

The GCGR Protein serves as a G-protein coupled receptor for glucagon, playing a pivotal role in the regulation of blood glucose levels and glucose homeostasis. It actively regulates hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, making it a key mediator of responses to fasting. Upon ligand binding, the receptor undergoes a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins), subsequently modulating downstream effectors such as adenylate cyclase. This modulation results in the activation of adenylate cyclase. Furthermore, the receptor contributes to signaling via a phosphatidylinositol-calcium second messenger system, underscoring its multifaceted role in glucose regulation.

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC₅₀ is <6.666 ng/mL.

Human

HEK293

C-Myc;N-10*His

P47871 (A26-K136)

2642  [NCBI]

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Approximately 35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.