GCSH Protein, Human (His)

GCSH protein, a vital component of the glycine cleavage system, efficiently shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST), contributing to glycine degradation. GCSH Protein, Human (His) is the recombinant human-derived GCSH protein, expressed by E. coli , with N-His labeled tag. The total length of GCSH Protein, Human (His) is 125 a.a., with molecular weight of ~17 KDa.

The glycine cleavage system, facilitated by the glycine cleavage system H protein (GCSH), is integral to the degradation of glycine. In this process, GCSH plays a crucial role by efficiently shuttling the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST).

Human

E. coli

N-His

P23434 (S49-E173)

2653  [NCBI]

SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Approximately 17 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.