1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Growth Differentiation Factor
  5. Growth Differentiation Factor 5 (GDF-5)
  6. GDF-5 Protein, Human

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free. The total length of GDF-5 Protein, Human is 120 a.a., with molecular weight of ~15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE GDF-5 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. GDF-5 Protein, Human is the recombinant human-derived GDF-5 protein, expressed by E. coli , with tag free. The total length of GDF-5 Protein, Human is 120 a.a., with molecular weight of ~15 kDa.

Background

GDF-5 Protein plays a pivotal role in bone and cartilage formation, intricately regulating chondrogenic tissue differentiation through dual pathways. Firstly, it positively influences chondrogenic tissue differentiation by binding with high affinity to BMPR1B and with lower affinity to BMPR1A, leading to the induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and subsequent SMAD protein signaling transduction. Simultaneously, it negatively regulates chondrogenic differentiation through interaction with NOG. This protein is essential for preventing excessive muscle loss upon denervation, a function mediated by phosphorylated SMAD1/5/8. Additionally, GDF-5 binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Structurally, it forms homodimers linked by disulfide bonds and interacts with serine proteases HTRA1 and HTRA3. Following LPS binding, GDF-5 may form a complex with CXCR4, HSP90AA1, and HSPA8. Moreover, it interacts with high affinity with NOG to inhibit chondrogenesis and with BMPR1B and BMPR1A to positively regulate chondrocyte differentiation through SMAD-dependent signaling. Additionally, it engages in interactions with FBN1 and FBN2.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P43026 (A382-R501)

Gene ID
Molecular Construction
N-term
GDF-5 (A382-R501)
Accession # P43026
C-term
Synonyms
Growth/differentiation factor 5; GDF-5; BMP-14; CDMP-1; LAP-4; Radotermin; CDMP1
AA Sequence

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Weight

Approximately 15 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-5 Protein, Human
Cat. No.:
HY-P72633
Quantity:
MCE Japan Authorized Agent: