GDF-9 Protein, Human (GST)

The GDF-9 protein is critical for ovarian folliculogenesis, promoting primordial follicle development and stimulating granulosa cell proliferation. It induces cell cycle transition, upregulates CCND1 and CCNE1 expression, and phosphorylates RB1. GDF-9 Protein, Human (GST) is the recombinant human-derived GDF-9 protein, expressed by E. coli , with N-GST labeled tag. The total length of GDF-9 Protein, Human (GST) is 135 a.a., with molecular weight of ~42.5 kDa.

GDF-9 protein is crucial for ovarian folliculogenesis, playing a pivotal role in promoting the development of primordial follicles and stimulating granulosa cell proliferation. It facilitates the transition of cells from G0/G1 to S and G2/M phases by upregulating the expression of CCND1 and CCNE1, along with phosphorylation of RB1. Additionally, GDF-9 regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. It counteracts the inhibitory effects of activin A on STAR expression and progesterone production by increasing inhibin B expression. Furthermore, GDF-9 suppresses the production of FST and FSTL3 in granulosa-lutein cells. While forming homodimers or heterodimers, unlike other family members, GDF-9 cannot undergo disulfide-linked interactions.

Human

E. coli

N-GST

O60383 (G320-R454)

2661  [NCBI]

QETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Approximately 42.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.