1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Growth Differentiation Factor
  5. Growth Differentiation Factor 9 (GDF-9)
  6. GDF-9 Protein, Human (GST)

The GDF-9 protein is critical for ovarian folliculogenesis, promoting primordial follicle development and stimulating granulosa cell proliferation. It induces cell cycle transition, upregulates CCND1 and CCNE1 expression, and phosphorylates RB1. GDF-9 Protein, Human (GST) is the recombinant human-derived GDF-9 protein, expressed by E. coli , with N-GST labeled tag. The total length of GDF-9 Protein, Human (GST) is 135 a.a., with molecular weight of ~42.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE GDF-9 Protein, Human (GST)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GDF-9 protein is critical for ovarian folliculogenesis, promoting primordial follicle development and stimulating granulosa cell proliferation. It induces cell cycle transition, upregulates CCND1 and CCNE1 expression, and phosphorylates RB1. GDF-9 Protein, Human (GST) is the recombinant human-derived GDF-9 protein, expressed by E. coli , with N-GST labeled tag. The total length of GDF-9 Protein, Human (GST) is 135 a.a., with molecular weight of ~42.5 kDa.

Background

GDF-9 protein is crucial for ovarian folliculogenesis, playing a pivotal role in promoting the development of primordial follicles and stimulating granulosa cell proliferation. It facilitates the transition of cells from G0/G1 to S and G2/M phases by upregulating the expression of CCND1 and CCNE1, along with phosphorylation of RB1. Additionally, GDF-9 regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. It counteracts the inhibitory effects of activin A on STAR expression and progesterone production by increasing inhibin B expression. Furthermore, GDF-9 suppresses the production of FST and FSTL3 in granulosa-lutein cells. While forming homodimers or heterodimers, unlike other family members, GDF-9 cannot undergo disulfide-linked interactions.

Species

Human

Source

E. coli

Tag

N-GST

Accession

O60383 (G320-R454)

Gene ID
Molecular Construction
N-term
GST
GDF-9 (G320-R454)
Accession # O60383
C-term
Synonyms
GDF9; Growth/differentiation factor 9; GDF-9
AA Sequence

QETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Molecular Weight

Approximately 42.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-9 Protein, Human (GST)
Cat. No.:
HY-P72425
Quantity:
MCE Japan Authorized Agent: