1. Recombinant Proteins
  2. Fluorescent-labeled Recombinant Proteins
  3. GFP Protein, Aequorea victoria (His)

GFP Protein, Aequorea victoria (His)

Cat. No.: HY-P71461
COA Handling Instructions

The GFP protein acts as an energy transfer receptor and is actively involved in the transduction of blue chemiluminescence produced by the protein aequorin. Its main function is to convert this chemical energy into green fluorescence through an efficient energy transfer process. GFP Protein, Aequorea victoria (His) is the recombinant GFP protein, expressed by E. coli , with N-6*His labeled tag. The total length of GFP Protein, Aequorea victoria (His) is 238 a.a., with molecular weight of 27-31 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $30 In-stock
10 μg $48 In-stock
50 μg $125 In-stock
100 μg $200 In-stock
500 μg $600 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GFP protein acts as an energy transfer receptor and is actively involved in the transduction of blue chemiluminescence produced by the protein aequorin. Its main function is to convert this chemical energy into green fluorescence through an efficient energy transfer process. GFP Protein, Aequorea victoria (His) is the recombinant GFP protein, expressed by E. coli , with N-6*His labeled tag. The total length of GFP Protein, Aequorea victoria (His) is 238 a.a., with molecular weight of 27-31 kDa.

Background

The Green Fluorescent Protein (GFP) serves as an energy-transfer acceptor, converting the blue chemiluminescence emitted by the protein aequorin into green fluorescent light through energy transfer. GFP's unique ability to fluoresce in vivo is contingent upon receiving energy from the Ca(2+)-activated photoprotein aequorin. This remarkable property has made GFP an invaluable tool in molecular and cellular biology, enabling the visualization of specific proteins and cellular structures in living organisms. The utilization of GFP as a fluorescent marker has revolutionized biological research, facilitating non-invasive and real-time imaging of dynamic cellular processes (

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P42212 (M1-K238)

Gene ID

/

Molecular Construction
N-term
6*His
GFP (M1-K238)
Accession # P42212
C-term
Synonyms
GFPGreen fluorescent protein
AA Sequence

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Molecular Weight

27-31 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 1 year, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GFP Protein, Aequorea victoria (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFP Protein, Aequorea victoria (His)
Cat. No.:
HY-P71461
Quantity:
MCE Japan Authorized Agent: