1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GFPT1 Protein, Human

As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.

Background

The GFPT1 protein exerts control over the flux of glucose into the hexosamine pathway and is likely crucial in regulating the availability of precursors necessary for both N- and O-linked glycosylation of proteins. Additionally, it plays a role in the circadian regulation of clock genes such as BMAL1 and CRY1, suggesting its involvement in modulating circadian rhythms. Moreover, GFPT1 is implicated in fine-tuning the metabolic fluctuations of cytosolic UDP-GlcNAc, particularly influencing its effects on hyaluronan synthesis during tissue remodeling. These diverse functions underscore the significance of GFPT1 in coordinating metabolic processes and cellular responses related to glycosylation, circadian rhythm, and tissue remodeling.

Biological Activity

Measured by its ability to catalyzes the reaction of glutamine and F-6-P to produce glutamate and GlcN-6-P. The specific activity is 1.038 nmoL/min/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q06210-1/AAA58502.1 (Q332-E699)

Gene ID
Molecular Construction
N-term
GFPT1 (Q332-E699)
Accession # Q06210-1/AAA58502.1
C-term
Synonyms
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; GFAT1; GFAT; GFPT
AA Sequence

QQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE

Molecular Weight

Approximately 41.5 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GFPT1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFPT1 Protein, Human
Cat. No.:
HY-P76359
Quantity:
MCE Japan Authorized Agent: