GFPT1 Protein, Human

As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.

The GFPT1 protein exerts control over the flux of glucose into the hexosamine pathway and is likely crucial in regulating the availability of precursors necessary for both N- and O-linked glycosylation of proteins. Additionally, it plays a role in the circadian regulation of clock genes such as BMAL1 and CRY1, suggesting its involvement in modulating circadian rhythms. Moreover, GFPT1 is implicated in fine-tuning the metabolic fluctuations of cytosolic UDP-GlcNAc, particularly influencing its effects on hyaluronan synthesis during tissue remodeling. These diverse functions underscore the significance of GFPT1 in coordinating metabolic processes and cellular responses related to glycosylation, circadian rhythm, and tissue remodeling.

Measured by its ability to catalyzes the reaction of glutamine and F-6-P to produce glutamate and GlcN-6-P. The specific activity is 1.038 nmoL/min/mg.

Human

E. coli

Tag Free

Q06210-1/AAA58502.1 (Q332-E699)

2673  [NCBI]

QQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE

Approximately 41.5 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.