1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. GGACT Protein, Human (HEK293, His)

The GGACT protein uses its enzymatic activity to break cross-links between lysine and glutamate residues, actively promoting the degradation of proteins cross-linked by transglutaminase. In addition, GGACT catalyzes the formation of 5-oxo-L-proline from the substrate L-γ-glutamyl-L-ε-lysine. GGACT Protein, Human (HEK293, His) is the recombinant human-derived GGACT protein, expressed by HEK293 , with N-6*His labeled tag. The total length of GGACT Protein, Human (HEK293, His) is 153 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GGACT protein uses its enzymatic activity to break cross-links between lysine and glutamate residues, actively promoting the degradation of proteins cross-linked by transglutaminase. In addition, GGACT catalyzes the formation of 5-oxo-L-proline from the substrate L-γ-glutamyl-L-ε-lysine. GGACT Protein, Human (HEK293, His) is the recombinant human-derived GGACT protein, expressed by HEK293 , with N-6*His labeled tag. The total length of GGACT Protein, Human (HEK293, His) is 153 a.a., with molecular weight of ~18.0 kDa.

Background

GGACT (Gamma-glutamylamine cyclotransferase), also known as 5-oxoprolinase, plays a crucial role in the degradation of proteins cross-linked by transglutaminases by cleaving the cross-link between a lysine and a glutamic acid residue. Additionally, GGACT catalyzes the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine. Notably, GGACT exhibits inactivity with substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine, suggesting substrate specificity in its enzymatic activity. The enzyme's ability to target specific cross-linked protein structures highlights its importance in cellular processes associated with protein turnover and degradation.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q9BVM4 (M1-R153)

Gene ID
Molecular Construction
N-term
6*His
GGACT (M1-R153)
Accession # Q9BVM4
C-term
Synonyms
Gamma-Glutamylaminecyclotransferase; GGACT; AIG2-Like Domain-Containing Protein 1; A2LD1
AA Sequence

MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GGACT Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GGACT Protein, Human (HEK293, His)
Cat. No.:
HY-P70902
Quantity:
MCE Japan Authorized Agent: