1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Growth Hormone/Somatotropin
  5. GH/Somatotropin Protein, Mouse

GH/Somatotropin Protein, Mouse

Cat. No.: HY-P70261
SDS COA Handling Instructions

GH/Somatotropin Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $250 In-stock
100 μg $400 In-stock
500 μg $800 In-stock
1 mg $1150 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GH/Somatotropin Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.

Background

Growth Hormone (Somatotropin) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the treatment of growth disorders in children[1]. Growth Hormone is a stress hormone that stimulates production of IGF-1 and raises the concentration of glucose and free fatty acids[2]. Growth Hormone exerts some of its effects by binding to receptors on target cells, where it activates the MAPK/ERK pathway[3].

Biological Activity

Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is ≤0.1051 ng/mL, corresponding to a specific activity is ≥9.515×106 U/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P06880 (F27-F216)

Gene ID
Molecular Construction
N-term
GH (F27-F216)
Accession # P06880
C-term
Synonyms
rMuSomatotropin/GH; Somatotropin; Growth Hormone; Gh1; Gh
AA Sequence

FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Molecular Weight

Approximately 20.0-23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 4% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 500 mM NaCl, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GH/Somatotropin Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GH/Somatotropin Protein, Mouse
Cat. No.:
HY-P70261
Quantity:
MCE Japan Authorized Agent: