GIPR Protein, Human (HEK293, His)

GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, His) is the recombinant human-derived GIPR, expressed by HEK293 , with C-10*His labeled tag. The total length of GIPR Protein, Human (HEK293, His) is 117 a.a.,

The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.

Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody. The EC₅₀ is ≤20 ng/mL.

Human

HEK293

C-10*His

P48546-1 (R22-Q138)

2696

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

28 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.