1. Recombinant Proteins
  2. Others
  3. GJA1 Protein, Human (His)

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GJA1 Protein, Human (His) is 150 a.a., with molecular weight of ~22 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GJA1 Protein, Human (His) is 150 a.a., with molecular weight of ~22 kDa.

Background

The GJA1 Protein serves as a gap junction protein with regulatory roles in bladder capacity. Comprising closely packed pairs of transmembrane channels called connexons, it facilitates the diffusion of low molecular weight materials between neighboring cells. This protein plays a crucial role in hearing physiology by participating in the recycling of potassium to the cochlear endolymph. Acting as a negative regulator of bladder functional capacity, GJA1 enhances intercellular electrical and chemical transmission, sensitizing bladder muscles to cholinergic neural stimuli and causing contraction. Additionally, it may contribute to cell growth inhibition through the regulation of NOV expression and localization. Essential for gap junction communication in the ventricles, GJA1 interacts with various proteins, including TJP1, SRC, UBQLN4, SGSM3, CNST, RIC1/CIP150, CSNK1D, NOV, and TMEM65, thereby playing a multifaceted role in cellular communication and regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P17302 (F233-I382)

Gene ID
Molecular Construction
N-term
6*His
GJA1 (F233-I382)
Accession # P17302
C-term
Synonyms
Connexin 43; Connexin-43; Cx 43; Cx43; CXA1_HUMAN; DFNB38; Gap junction 43 kDa heart protein; Gap junction alpha-1 protein; Gap junction protein alpha 1 43kDa connexin 43; ; Gap junction protein alpha 1 43kDa; Gap junction protein alpha like; GJA 1; Gja1; GJAL; ODD; ODDD; ODOD; SDTY3
AA Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Molecular Weight

Approximately 22 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

GJA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GJA1 Protein, Human (His)
Cat. No.:
HY-P72205
Quantity:
MCE Japan Authorized Agent: