1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein, Human (HEK293, His)

Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein, Human (HEK293, His)

Cat. No.: HY-P70300
SDS COA Handling Instructions

Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein is a lysosomal enzyme present in all cells. It is involved in the catabolism of heparin, heparin sulfate and keratin sulfate. Deficiency of this enzyme leads to inadequate substrate accumulation and lysosomal storage impairment IIID mucopolysaccharidosis. Glucosamine (N-acetyl) -6-Sulfatase/GNS Protein, Human (HEK293, His) is the recombinant human-derived Glucosamine, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein is a lysosomal enzyme present in all cells. It is involved in the catabolism of heparin, heparin sulfate and keratin sulfate. Deficiency of this enzyme leads to inadequate substrate accumulation and lysosomal storage impairment IIID mucopolysaccharidosis. Glucosamine (N-acetyl) -6-Sulfatase/GNS Protein, Human (HEK293, His) is the recombinant human-derived Glucosamine, expressed by HEK293 , with C-6*His labeled tag.

Background

Sulfatase catalyzes the hydrolysis of O- and N-sulfate esters from various substrates. Most sulfatases are found in lysosomes. Used to remove sulfate from glycosaminoglycans (GAGs), glycopeptides and glycolipids (GLs). N-acetylglucosamine-6-sulfatase is a lysosomal enzyme present in all cells. It is involved in the catabolism of heparin, heparin sulfate and keratin sulfate. Deficiency of this enzyme leads to inadequate substrate accumulation and lysosomal storage impairment IIID mucopolysaccharidosis[1][2][3][4].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P15586-1 (V37-L552)

Gene ID
Molecular Construction
N-term
GNS (V37-L552)
Accession # P15586-1
6*His
C-term
Synonyms
rHuN-acetylglucosamine-6-sulfatase/GNS, His; N-Acetylglucosamine-6-Sulfatase; Glucosamine-6-Sulfatase; G6S; GNS
AA Sequence

VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL

Molecular Weight

Approximately 90 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein, Human (HEK293, His)
Cat. No.:
HY-P70300
Quantity:
MCE Japan Authorized Agent: