GM-CSF Protein, Mouse (HEK293, Fc)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with N-hFc labeled tag. The total length of GM-CSF Protein, Mouse (HEK293, Fc) is 124 a.a., with molecular weight of 45-60 kDa.

Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) is a cytokine known for its role in stimulating the growth and differentiation of hematopoietic precursor cells across various lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer. Its signaling mechanism involves interaction with the GM-CSF receptor complex, which forms a dodecamer consisting of two head-to-head hexamers involving two alpha, two beta, and two ligand subunits. Through this intricate receptor complex, GM-CSF orchestrates the regulation of hematopoiesis, contributing to the development and maturation of diverse blood cell types.

Immobilized Mouse GM-CSF R alpha, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Mouse GM-CSF, hFc Tag with the EC₅₀ of <2.8 ng/mL determined by ELISA.

Mouse

HEK293

N-hFc

P01587 (A18-K141)

12981  [NCBI]

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

45-60 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.