GM-CSF Protein, Mouse (His)

GM-CSF Protein, Mouse is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells.

Granulocyte Macrophage Colony Stimulating Factor is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells including mature neutrophils, macrophages, and dendritic cells^[1].

Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED₅₀ for this effect is 9.304-24.86 pg/mL, corresponding to a specific activity is 4.023×10⁷-1.075×10⁸ units/mg.

• 
  Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED₅₀ for this effect is 9.304-24.86 pg/mL, corresponding to a specific activity is 4.023×10⁷-1.075×10⁸ units/mg.

Mouse

E. coli

N-6*His

Q14AD9 (A18-K141)

12981

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Approximately 17 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.