1. Recombinant Proteins
  2. Others
  3. GM2A Protein, Human (HEK293, His)

Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. GM2A catalyzes the degradation of the ganglioside GM2 as well as affects lipid storage and neuromuscular process controlling balance. GM2A Protein, Human (HEK293, His) is the recombinant human-derived GM2A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GM2A Protein, Human (HEK293, His) is 162 a.a., with molecular weight of 19-22 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. GM2A catalyzes the degradation of the ganglioside GM2 as well as affects lipid storage and neuromuscular process controlling balance. GM2A Protein, Human (HEK293, His) is the recombinant human-derived GM2A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GM2A Protein, Human (HEK293, His) is 162 a.a., with molecular weight of 19-22 kDa.

Background

Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. GM2A, together with beta-hexosaminidase A, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in GM2A result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease.
The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits calcium-independent phospholipase activity, cholesterol transfer activity as well as affects lipid storage and neuromuscular process controlling balance[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH09273.1 (S32-I193)

Gene ID
Molecular Construction
N-term
GM2A (S32-I193)
Accession # AAH09273.1
6*His
C-term
Synonyms
Ganglioside GM2 activator; Cerebroside sulfate activator protein; GM2-AP; Sphingolipid activator protein 3; SAP-3
AA Sequence

SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Molecular Weight

19-22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

GM2A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM2A Protein, Human (HEK293, His)
Cat. No.:
HY-P70954
Quantity:
MCE Japan Authorized Agent: