GMP Noggin Protein, Human (HEK293)

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. GMP Noggin Protein, Human (HEK293) is the recombinant human-derived Noggin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GMP Noggin Protein, Human (HEK293) is 205 a.a., with molecular weight of ~28-32 kDa.

Noggin protein emerges as a crucial inhibitor in the intricate realm of bone morphogenetic proteins (BMP) signaling, playing indispensable roles in neural tube and somite growth, as well as contributing to the intricate processes of cartilage morphogenesis and joint formation. Operating through its homodimeric structure, Noggin establishes a significant interaction with GDF5, and likely GDF6, exerting its inhibitory influence on chondrocyte differentiation. This molecular interplay underscores Noggin's pivotal position in regulating key aspects of embryonic development, emphasizing its nuanced involvement in sculpting the intricate patterns and structures critical for proper growth and morphogenesis.

Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED₅₀ for this effect is ≤0.13 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP‑2.

Human

HEK293

C-6*His

Q13253 (Q28-C232)

9241  [NCBI]

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 28-32 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 20mM PB, 500mM NaCl, 2mM EDTA, pH 7.4.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23(12):4126-4134.  [Content Brief]