1. Recombinant Proteins
  2. Complement System GMP-grade Proteins
  3. Complement Regulatory Proteins
  4. Vitronectin
  5. GMP Vitronectin Protein, Human (HEK293, His)

Vitronectin is a key cell adhesion factor in serum and tissues and plays a crucial role in cell interactions by binding to glycosaminoglycans and proteoglycans. It is recognized by specific integrins and serves as an important adhesion molecule, facilitating cell-matrix interactions. GMP Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GMP Vitronectin Protein, Human (HEK293, His) is 459 a.a., with molecular weight of 60-80 kDa.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Vitronectin is a key cell adhesion factor in serum and tissues and plays a crucial role in cell interactions by binding to glycosaminoglycans and proteoglycans. It is recognized by specific integrins and serves as an important adhesion molecule, facilitating cell-matrix interactions. GMP Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GMP Vitronectin Protein, Human (HEK293, His) is 459 a.a., with molecular weight of 60-80 kDa.

Background

Vitronectin, a pivotal cell adhesion and spreading factor present in both serum and tissues, plays a crucial role in cellular interactions. It engages with glycosaminoglycans and proteoglycans, demonstrating its versatility in molecular interactions. Recognized by specific integrins, Vitronectin serves as a vital cell-to-substrate adhesion molecule, facilitating cellular adhesion processes. Additionally, it acts as an inhibitor, mitigating the membrane-damaging effects associated with the terminal cytolytic complement pathway. Notably, Vitronectin establishes connections with various molecules, including SERPINE1/PAI1, insulin, and C1QBP, showcasing its involvement in diverse cellular processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH05046.1 (D20-L478)

Gene ID
Molecular Construction
N-term
GMP Vitronectin (D20-L478)
Accession # AAH05046.1
6*His
C-term
Synonyms
Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN
AA Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Molecular Weight

60-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP Vitronectin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP Vitronectin Protein, Human (HEK293, His)
Cat. No.:
HY-P70485G
Quantity:
MCE Japan Authorized Agent: