GPA33 Protein, Human (HEK293, His)

The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (HEK293, His) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-6*His labeled tag.

The GPA33 protein is implicated in potentially playing a role in cell-cell recognition and signaling, suggesting its involvement in fundamental cellular processes related to intercellular communication. The precise mechanisms by which GPA33 operates in cell-cell recognition and signaling remain areas of interest, underscoring its potential significance in mediating molecular interactions that contribute to cellular responses. The versatile nature of GPA33 in these processes highlights its potential role in coordinating cellular recognition events and modulating signaling cascades, emphasizing the need for further exploration to elucidate its specific functions and molecular mechanisms.

Human

HEK293

C-6*His

Q99795 (I22-V235)

10223  [NCBI]

ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV

34-37 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.