GPA33 Protein, Mouse (HEK293, His)

The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPA33 Protein, Mouse (HEK293, His) is 214 a.a., with molecular weight of 31-39 kDa.

The GPA33 protein appears to play a pivotal role in cell-cell recognition and signaling, indicating its involvement in fundamental cellular processes. Its potential influence suggests a significance in mediating interactions between cells and participating in crucial signaling events. Further exploration into the specific mechanisms through which GPA33 functions in cell-cell recognition and signaling could provide valuable insights into its broader role in cellular communication and may uncover its potential contributions to various physiological and developmental processes.

Mouse

HEK293

C-6*His

Q9JKA5/NP_067623.1 (L22-I235)

59290  [NCBI]

LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI

Approximately 31-39 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.