1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GPX7 Protein, Human (HEK293, Fc)

GPX7, a protein with catalase activity, is predicted to respond to oxidative stress. It is located in the endoplasmic reticulum and is expressed in various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2). This highlights the potential importance of GPX7 in antioxidative processes throughout the body. GPX7 Protein, Human (HEK293, Fc) is the recombinant human-derived GPX7 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GPX7, a protein with catalase activity, is predicted to respond to oxidative stress. It is located in the endoplasmic reticulum and is expressed in various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2). This highlights the potential importance of GPX7 in antioxidative processes throughout the body. GPX7 Protein, Human (HEK293, Fc) is the recombinant human-derived GPX7 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

GPX7, a protein endowed with catalase activity, is predicted to play a role in the cellular response to oxidative stress. Situated in the endoplasmic reticulum, GPX7 demonstrates ubiquitous expression across various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2), underscoring its potential significance in antioxidative processes throughout the body.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q96SL4/NP_056511.2 (Q20-L187)

Gene ID
Molecular Construction
N-term
GPX7 (Q20-L187)
Accession # Q96SL4/NP_056511.2
hFc
C-term
Synonyms
Glutathione peroxidase 7; GPx-7; GSHPx-7; CL683; GPX6
AA Sequence

QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Molecular Weight

Approximately 47 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GPX7 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GPX7 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75798
Quantity:
MCE Japan Authorized Agent: