1. Recombinant Proteins
  2. Receptor Proteins Biotinylated Proteins
  3. Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, mFc-Avi)

Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, mFc-Avi)

Cat. No.: HY-P700413
Handling Instructions Technical Support

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Growth Hormone R (GHR) is the receptor for pituitary growth hormone, crucial in postnatal body growth regulation. Binding to its ligand activates the JAK2/STAT5 pathway, facilitating intracellular signaling. The soluble form, GHBP (Growth Hormone Binding Protein), acts as a growth hormone reservoir in the bloodstream. GHBP may modulate or inhibit growth hormone signaling, contributing to intricate growth process regulation. Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

Background

Growth Hormone R (GHR) functions as the receptor for pituitary gland growth hormone, playing a pivotal role in the regulation of postnatal body growth. Upon binding to its ligand, GHR activates the JAK2/STAT5 pathway, facilitating the intracellular signaling cascade. Additionally, the soluble form of the receptor, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the bloodstream. GHBP may also exert modulatory or inhibitory effects on growth hormone signaling, contributing to the intricate regulation of growth processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human GH1 at 2 μg/ml can bind Biotinylated human GHR, the EC50 is 3.089-4.754 ng/mL.

Species

Human

Source

HEK293

Tag

C-Avi;C-mFc

Accession

P10912-1 (A27-Y264)

Gene ID
Molecular Construction
N-term
GHR (A27-Y264)
Accession # P10912-1
mFc-Avi
C-term
Synonyms
Somatotropin receptor Serum-binding protein;
AA Sequence

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Molecular Weight

85 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, mFc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Human (Biotinylated, HEK293, mFc-Avi)
Cat. No.:
HY-P700413
Quantity:
MCE Japan Authorized Agent: