GSTP1 Protein, Human (His)

The GSTP1 protein is critical for binding reduced glutathione to a variety of hydrophobic electrophiles, actively forming glutathione conjugates of PGA2 and PGJ2. Documented studies highlight its involvement in hepoxilin regioisomer synthesis, emphasizing the versatility of GSTP1 in processing substrates. GSTP1 Protein, Human (His) is the recombinant human-derived GSTP1 protein, expressed by E. coli , with N-10*His labeled tag. The total length of GSTP1 Protein, Human (His) is 209 a.a., with molecular weight of ~25 kDa.

The GSTP1 protein plays a crucial role in the cellular process of conjugating reduced glutathione to a diverse range of exogenous and endogenous hydrophobic electrophiles. Specifically, GSTP1 is actively involved in the formation of glutathione conjugates for prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2), as documented in studies. Furthermore, GSTP1 participates in the synthesis of novel hepoxilin regioisomers, underscoring its versatility in handling various substrates. Beyond its role in detoxification, GSTP1 negatively regulates CDK5 activity by facilitating the translocation of p25/p35, serving as a crucial mechanism to prevent neurodegeneration.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-10*His

P09211 (P2-Q210)

2950  [NCBI]

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Approximately 25-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.