1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTP1 Protein, Rat (His)

GSTP1 protein conjugates reduced glutathione to hydrophobic electrophiles, forms glutathione conjugates of PGA2 and PGJ2, and contributes to hepoxilin production.It also regulates CDK5 activity by facilitating p25/p35 translocation, preventing neurodegeneration.GSTP1 Protein, Rat (His) is the recombinant rat-derived GSTP1 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GSTP1 protein conjugates reduced glutathione to hydrophobic electrophiles, forms glutathione conjugates of PGA2 and PGJ2, and contributes to hepoxilin production.It also regulates CDK5 activity by facilitating p25/p35 translocation, preventing neurodegeneration.GSTP1 Protein, Rat (His) is the recombinant rat-derived GSTP1 protein, expressed by E.coli , with N-6*His labeled tag.

Background

GSTP1 protein is responsible for conjugating reduced glutathione to various hydrophobic electrophiles, both exogenous and endogenous. It plays a role in forming glutathione conjugates of prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2), as well as contributing to the production of unique hepoxilin regioisomers. Additionally, GSTP1 helps regulate CDK5 activity by facilitating the translocation of p25/p35, thereby preventing neurodegeneration.

Biological Activity

Measured by the conjugation of reduced glutathione to 2mM 1-bromo-2,4-dinitrobenzene that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is ≤26085.069 pmol/min/μg.

Species

Rat

Source

E. coli

Tag

N-6*His

Accession

P04906 (P2-Q210)

Gene ID
Molecular Construction
N-term
6*His
GSTP1 (P2-Q210)
Accession # P04906
C-term
Synonyms
Gstp1; Glutathione S-transferase P; EC 2.5.1.18; Chain 7; GST 7-7; GST class-pi
AA Sequence

PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ

Molecular Weight

Approximately 24 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GSTP1 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTP1 Protein, Rat (His)
Cat. No.:
HY-P72217
Quantity:
MCE Japan Authorized Agent: