1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. GZMA/Granzyme A Protein, Mouse (His)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.

Background

Granzyme A (GZMA) is a highly abundant protease found in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a crucial role in immune defense mechanisms. When delivered into the target cell through the immunological synapse, GZMA activates caspase-independent pyroptosis. It exhibits a substrate specificity for cleavage after lysine or arginine residues. Notably, GZMA cleaves APEX1 after 'Lys-31,' disrupting its oxidative repair activity. Additionally, it targets the nucleosome assembly protein SET, cleaving it after 'Lys-189.' This cleavage event disrupts SET's nucleosome assembly activity and facilitates the translocation of the SET complex into the nucleus, where it is involved in nicking and degrading DNA. The multifunctional activities of GZMA underscore its significance in orchestrating diverse cellular processes during immune responses.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P11032 (I29-V260)

Gene ID

14938

Molecular Construction
N-term
GZMA (I29-V260)
Accession # P11032
6*His
C-term
Synonyms
Gzma; Ctla-3; Ctla3; Mtsp-1; Granzyme A; EC 3.4.21.78; Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1; TSP-1
AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Molecular Weight

32.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GZMA/Granzyme A Protein, Mouse (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GZMA/Granzyme A Protein, Mouse (His)
Cat. No.:
HY-P704020
Quantity:
MCE Japan Authorized Agent: