1. Recombinant Proteins
  2. Others
  3. H2BC11 Protein, Human

The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free. The total length of H2BC11 Protein, Human is 125 a.a., with molecular weight of ~13.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free. The total length of H2BC11 Protein, Human is 125 a.a., with molecular weight of ~13.8 kDa.

Background

Histone H2BC11 is an essential component of the nucleosome, which serves as the fundamental unit of chromatin, responsible for wrapping and compacting DNA. This compaction limits DNA accessibility to cellular machineries, impacting transcription regulation, DNA repair, replication, and chromosomal stability. Histones, including H2BC11, play a central role in these processes. The regulation of DNA accessibility involves a complex array of post-translational modifications, known as the histone code, and nucleosome remodeling. Beyond its role in chromatin organization, H2BC11 exhibits broad antibacterial activity, suggesting its potential involvement in the formation of the functional antimicrobial barrier of the colonic epithelium. Moreover, H2BC11 may contribute to the bactericidal activity of amniotic fluid, extending its functional significance beyond chromatin dynamics to host defense mechanisms against microbial threats.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P06899 (P2-K126)

Gene ID
Molecular Construction
N-term
H2BC11 (P2-K126)
Accession # P06899
C-term
Synonyms
H2BC11; Histone H2B type 1-J
AA Sequence

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Molecular Weight

Approximately 13.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

H2BC11 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
H2BC11 Protein, Human
Cat. No.:
HY-P72329
Quantity:
MCE Japan Authorized Agent: