HABP1/C1QBP Protein, Mouse (His)

HABP1/C1QBP Protein, part of the MAM33 family, is associated with a distinct protein family known for unique characteristics and functions. In the MAM33 family, HABP1 likely plays a significant role in associated cellular processes, though specific functions need exploration. Investigating HABP1's functions and implications within the broader MAM33 family will enhance understanding of its unique properties and potential roles in cellular processes, offering insights into its significance within this protein family. HABP1/C1QBP Protein, Mouse (His) is the recombinant mouse-derived HABP1/C1QBP protein, expressed by E. coli, with N-His labeled tag. The total length of HABP1/C1QBP Protein, Mouse (His) is 208 a.a., with molecular weight of ~32 KDa.

HABP1/C1QBP protein is a member of the MAM33 family, categorizing it within a specific protein family known for its distinctive characteristics and functions. As part of the MAM33 family, HABP1 likely plays a significant role in cellular processes associated with this family, though specific functions require further exploration. Investigating the functions and implications of HABP1 within the broader context of the MAM33 family will contribute to a better understanding of its unique properties and potential roles in cellular processes, providing insights into its significance within this protein family.

Mouse

E. coli

N-His

Q8R5L1 (L72-Q279)

12261  [NCBI]

LHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ

Approximately 32 kDa.

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.