HADHB Protein, Human (GST)

HADHB protein is an important component of mitochondrial trifunctional enzymes and directs three decisive reactions in the mitochondrial β-oxidation pathway. This pathway is critical for generating energy across tissues, breaking down long-chain fatty acids into acetyl-CoA. HADHB Protein, Human (GST) is the recombinant human-derived HADHB protein, expressed by E. coli , with N-GST labeled tag.

HADHB protein serves as an integral component of the mitochondrial trifunctional enzyme, orchestrating the final three reactions within the mitochondrial beta-oxidation pathway. This crucial pathway is paramount for energy production in various tissues, breaking down fatty acids into acetyl-CoA through a series of four consecutive reactions. Specifically tailored for long-chain fatty acids, the trifunctional enzyme operates as a heterotetrameric complex composed of two distinct subunits. HADHA, carrying 2,3-enoyl-CoA hydratase and 3-hydroxyacyl-CoA dehydrogenase activities, partners with HADHB, the focus here, which houses the 3-ketoacyl-CoA thiolase activity. This intricate collaboration underscores HADHB's pivotal role in driving the final steps of mitochondrial beta-oxidation, contributing to energy homeostasis in cellular metabolism.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-GST

P55084-1 (A35-P283)

3032  [NCBI]

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Approximately 53.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.