HB-EGF Protein, Human (sf9)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (sf9) is the recombinant human-derived HB-EGF protein, expressed by Sf9 insect cells , with tag free. The total length of HB-EGF Protein, Human (sf9) is 86 a.a., with molecular weight of ~16.4 kDa.

HB-EGF Protein, a versatile growth factor, exerts its regulatory effects through EGFR, ERBB2, and ERBB4. Crucial for cardiac valve formation and normal heart function, HB-EGF plays a pivotal role in promoting smooth muscle cell proliferation and may contribute to macrophage-mediated cellular proliferation. Exhibiting mitogenic properties for fibroblasts while sparing endothelial cells, HB-EGF distinguishes itself by binding to EGF receptor/EGFR with greater affinity than EGF, emerging as a more potent mitogen for smooth muscle cells. Beyond its proliferative role, HB-EGF serves as a diphtheria toxin receptor and engages in interactions with FBLN1. The multifaceted interactions of HB-EGF with EGFR and ERBB4 underscore its central role in cellular regulation and cardiovascular development.

Human

Sf9 insect cells

Tag Free

Q99075 (D63-L148)

1839  [NCBI]

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Approximately 16.4 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.