HBP1 Protein, Human (His)

HBP1 is a transcriptional repressor that regulates target genes by binding specifically to promoter regions, specifically favoring the sequence 5'-TTCATTCATTCA-3'.Its key role in the cell cycle and Wnt pathway involves promoting enhanced binding to the histone H1.0 promoter through the RB1 interaction.HBP1 Protein, Human (His) is the recombinant human-derived HBP1 protein, expressed by E.coli , with N-His labeled tag.

HBP1, a transcriptional repressor, exerts its regulatory influence by binding specifically to the promoter region of target genes. It plays a pivotal role in governing both the cell cycle and the Wnt pathway, displaying a preference for the sequence 5'-TTCATTCATTCA-3'. The interaction with RB1 enhances its binding to the histone H1.0 promoter, contributing to its regulatory function. Additionally, HBP1 disrupts the DNA-TCF4 interaction and binds to the second PAH repeat of SIN3A. Notably, it engages in direct interactions with TCF4 and RB1, further underscoring its involvement in intricate regulatory networks.

Human

E. coli

N-His

O60381 (P208-F345)

26959  [NCBI]

PSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINF

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.