HDHD2 Protein, Human (His)

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) is a member of haloacid dehydrogenase (HAD)-like superfamily with hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities^[1][2].

Human

E. coli

N-6*His

Q9H0R4-1 (M1-L259)

84064  [NCBI]

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.