HE4/WFDC2 Protein, Canine (HEK293, Fc)

HE4/WFDC2 protein acts as a broad-spectrum protease inhibitor and may affect a variety of cellular processes. Its effect on sperm maturation suggests its role in reproductive mechanisms. HE4/WFDC2 Protein, Canine (HEK293, Fc) is the recombinant canine-derived HE4/WFDC2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of HE4/WFDC2 Protein, Canine (HEK293, Fc) is 97 a.a., with molecular weight of ~43-50 kDa.

HE4/WFDC2 Protein serves as a broad-spectrum protease inhibitor, potentially contributing to diverse cellular processes. Its putative role in sperm maturation suggests involvement in reproductive mechanisms. Structurally, it forms a homotrimer through disulfide linkages, highlighting its oligomeric nature. The multifaceted function of HE4/WFDC2 in protease regulation and potential impact on reproductive processes underscores its significance in cellular homeostasis.

Canine

HEK293

C-hFc

Q28894/NP_001003241.1 (G28-F124)

403919  [NCBI]

GEVEKTGVCPQLQADLNCTQECVSDAQCADNLKCCQAGCATICHLPNEKEGSCPQVNTDFPQLGLCQDQCQVDSHCPGLLKCCYNGCGKVSCVTPIF

Approximately 43-50 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.