Hemoglobin subunit theta-1/HBQ1 Protein, Human (His)

Hemoglobin subunit theta-1 (HBQ1) is a protein belonging to the globin family. Globulin is a group of proteins involved in oxygen transport and storage. Hemoglobin subunit theta-1/HBQ1 Protein, Human (His) is the recombinant human-derived Hemoglobin subunit theta-1/HBQ1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Hemoglobin subunit theta-1/HBQ1 Protein, Human (His) is 142 a.a., with molecular weight of 15 kDa.

Hemoglobin subunit theta-1 (HBQ1) is a protein that belongs to the globin family. Globins are a group of proteins involved in oxygen transport and storage. HBQ1 is one of the lesser-known members of the globin family, and its specific functions and roles are not well characterized. It is believed to be mainly expressed in the embryonic and fetal stages of development, suggesting a potential role in oxygen transport during early development. However, further research is needed to fully understand the exact functions and significance of HBQ1 in oxygen metabolism and its potential implications in health and disease.

Human

E. coli

N-6*His

P09105 (M1-R142)

3049  [NCBI]

MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

15 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.