HEPACAM Protein, Human (HEK293, His)

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

HEPACAM protein emerges as a key regulator in the intricate orchestration of cell motility and interactions with the extracellular matrix. It exhibits the potential to curb cell growth by suppressing proliferation, suggesting a role in maintaining cellular homeostasis. The protein forms homodimers, with dimerization predominantly occurring through cis interactions on the cell surface. Notably, it is integral to a complex that includes MLC1, TRPV4, AQP4, and ATP1B1, highlighting its participation in a network of molecular interactions crucial for various cellular processes. The multifaceted involvement of HEPACAM underscores its significance in the intricate landscape of cellular dynamics and growth regulation.

Human

HEK293

C-6*His

Q14CZ8-1/NP_689935.2 (V34-S240)

220296  [NCBI]

VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSS

35-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.