HER3 Protein, Rat (HEK293, His)

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Rat (HEK293, His) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.

HER3, a tyrosine-protein kinase, serves as a critical cell surface receptor for neuregulins. Activated by neuregulin-1 (NRG1), ligand binding enhances phosphorylation on tyrosine residues and facilitates its interaction with the p85 subunit of phosphatidylinositol 3-kinase. Additionally, there is evidence suggesting activation by CSPG5. HER3 is intricately involved in the regulation of myeloid cell differentiation, highlighting its pivotal role in cellular processes crucial for normal development and function.

Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF‑7 human breast cancer cells. The ED₅₀ for this effect is 0.2227 μg/mL in the presence of 10 ng/mL Recombinant Human NRG1‑beta1 (HY-P70524), corresponding to a specific activity is 4490.34 units/mg.

• 
  Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF‑7 human breast cancer cells. The ED₅₀ for this effect is 0.2227 μg/mL in the presence of 10 ng/mL Recombinant Human NRG1‑beta1 (HY-P70524), corresponding to a specific activity is 4490.34 units/mg.

Rat

HEK293

C-His

G3V6N1/XP_017450189.1 (S20-H641)

29496/619374  [NCBI]

SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCHEVCKGRCWGPGPDDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRRFNDSGACVPRCPEPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTFCVRACPPDKMEVDKHGLKMCEPCGGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPSEERLDIKYNRPLGECLAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNFLQGEPREFVHEAQCFSCHPECLPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCNGPELQDCLGQAEVLMSKPH

Approximately 85-115 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.