Hirudin Protein, Poecilobdella viridis (P. pastoris)

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free. The total length of Hirudin Protein, Poecilobdella viridis (P. pastoris) is 63 a.a., with molecular weight of ~6.7 kDa.

Hirudin Protein emerges as a potent thrombin-specific protease inhibitor, showcasing its ability to form a stable non-covalent complex with alpha-thrombin. This interaction results in the effective abolition of alpha-thrombin's capacity to cleave fibrinogen, underscoring the critical role of hirudin in modulating key steps in the coagulation cascade. The specific and targeted inhibition of thrombin by hirudin highlights its significance as a therapeutic agent, particularly in contexts where precise regulation of blood clotting is essential.

The biological activity is determined by chromogenic assay, 1 unit is defined as the amount of Hirudin that neutralizes 1 unit of the WHO preparation 89/588 of thrombin. The specific activity is no less than 14,000 ATU/mg protein.

Others

P. pastoris

Tag Free

P84590 (V1-L63)

/

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Approximately 6.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PBS, pH 7.0, containing 2 % mannitol.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.