1. Recombinant Proteins
  2. Others
  3. HIST1H2BM Protein, Mouse (His)

HIST1H2BM Protein, Mouse (His)

Cat. No.: HY-P72225
Handling Instructions

The HIST1H2BM protein is a key part of the nucleosome, which compacts DNA into chromatin. HIST1H2BM Protein, Mouse (His) is the recombinant mouse-derived HIST1H2BM protein, expressed by E. coli , with N-6*His labeled tag. The total length of HIST1H2BM Protein, Mouse (His) is 125 a.a., with molecular weight of ~17.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HIST1H2BM protein is a key part of the nucleosome, which compacts DNA into chromatin. HIST1H2BM Protein, Mouse (His) is the recombinant mouse-derived HIST1H2BM protein, expressed by E. coli , with N-6*His labeled tag. The total length of HIST1H2BM Protein, Mouse (His) is 125 a.a., with molecular weight of ~17.8 kDa.

Background

HIST1H2BM protein functions as a core component of the nucleosome, a crucial architectural unit that envelops and compacts DNA into chromatin, thereby limiting DNA accessibility to cellular machineries dependent on DNA templates. Playing a pivotal role in transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability, histones contribute significantly to cellular processes. The regulation of DNA accessibility involves a sophisticated system of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome structure consists of a histone octamer, including two molecules each of H2A, H2B, H3, and H4, assembled into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, reflecting its central role in chromatin organization and genomic function.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P10854 (P2-K126)

Gene ID

319186  [NCBI]

Molecular Construction
N-term
6*His
HIST1H2BM (P2-K126)
Accession # P10854
C-term
Synonyms
H2bc14; Hist1h2bm; Histone H2B type 1-M; H2B 291B
AA Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Molecular Weight

Approximately 17.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HIST1H2BM Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HIST1H2BM Protein, Mouse (His)
Cat. No.:
HY-P72225
Quantity:
MCE Japan Authorized Agent: