1. Recombinant Proteins
  2. Others
  3. Histone H2A Protein, Xenopus laevis

Histone H2A, an integral nucleosome component, forms the histone octamer with H2B, H3, and H4. This molecular spool, consisting of two H2A-H2B heterodimers and one H3-H4 heterotetramer, wraps around approximately 147 base pairs of DNA, organizing chromatin structure. The intricate histone-DNA association, especially with H2A, plays a vital role in regulating cellular processes like gene expression and DNA packaging. Histone H2A Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2A protein, expressed by E. coli , with tag free. The total length of Histone H2A Protein, Xenopus laevis is 181 a.a., with molecular weight of ~12.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Histone H2A, an integral nucleosome component, forms the histone octamer with H2B, H3, and H4. This molecular spool, consisting of two H2A-H2B heterodimers and one H3-H4 heterotetramer, wraps around approximately 147 base pairs of DNA, organizing chromatin structure. The intricate histone-DNA association, especially with H2A, plays a vital role in regulating cellular processes like gene expression and DNA packaging. Histone H2A Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2A protein, expressed by E. coli , with tag free. The total length of Histone H2A Protein, Xenopus laevis is 181 a.a., with molecular weight of ~12.3 kDa.

Background

Histone H2A is a crucial component of the nucleosome, a fundamental structural unit in chromatin organization. The nucleosome comprises a histone octamer composed of two copies each of H2A, H2B, H3, and H4, with one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octameric assembly serves as a molecular spool around which approximately 147 base pairs of DNA are intricately wound, contributing to the compact and organized structure of chromatin. The intricate association of histones, including H2A, with DNA in the nucleosome is essential for the regulation of various cellular processes, including gene expression and DNA packaging.

Species

Xenopus laevis

Source

E. coli

Tag

Tag Free

Accession

Q6AZJ8 (T17-L197)

Gene ID

494591  [NCBI]

Molecular Construction
N-term
Histone H2A (T17-L197)
Accession # Q6AZJ8
C-term
Synonyms
h2ac14.L
AA Sequence

TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKL

Molecular Weight

Approximately 12.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Histone H2A Protein, Xenopus laevis Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Histone H2A Protein, Xenopus laevis
Cat. No.:
HY-P72330
Quantity:
MCE Japan Authorized Agent: