HLA-C Protein, Human (His)

HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C Protein, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli , with N-6*His labeled tag. The total length of HLA-C Protein, Human (His) is 284 a.a., with molecular weight of ~36.7 kDa.

HLA-C protein is a member of the major histocompatibility complex (MHC) class I family, placing it within a group of proteins that play crucial roles in the immune system by presenting antigens to cytotoxic T cells. As a part of the MHC class I family, HLA-C is involved in the regulation of immune responses and the recognition of foreign substances. Further exploration is necessary to uncover the specific functions and implications of HLA-C within the broader context of the MHC class I family, shedding light on its significance in immune surveillance and host defense mechanisms.

Human

E. coli

N-6*His

O78179 (C25-I308)

/

CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

Approximately 36.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.