1. Recombinant Proteins
  2. Others
  3. HLA-C Protein, Human (His)

HLA-C Protein, Human (His)

Cat. No.: HY-P71700
SDS COA Handling Instructions

HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C Protein, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli , with N-6*His labeled tag. The total length of HLA-C Protein, Human (His) is 284 a.a., with molecular weight of ~36.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C Protein, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli , with N-6*His labeled tag. The total length of HLA-C Protein, Human (His) is 284 a.a., with molecular weight of ~36.7 kDa.

Background

HLA-C protein is a member of the major histocompatibility complex (MHC) class I family, placing it within a group of proteins that play crucial roles in the immune system by presenting antigens to cytotoxic T cells. As a part of the MHC class I family, HLA-C is involved in the regulation of immune responses and the recognition of foreign substances. Further exploration is necessary to uncover the specific functions and implications of HLA-C within the broader context of the MHC class I family, shedding light on its significance in immune surveillance and host defense mechanisms.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O78179 (C25-I308)

Gene ID

/

Molecular Construction
N-term
6*His
HLA-C (C25-I308)
Accession # O78179
C-term
Synonyms
HLA class I histocompatibility antigen, C alpha chain; HLA-C protein; MHC class I antigen; HLA-Cw
AA Sequence

CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

Molecular Weight

Approximately 36.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HLA-C Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-C Protein, Human (His)
Cat. No.:
HY-P71700
Quantity:
MCE Japan Authorized Agent: