1. Recombinant Proteins
  2. Others
  3. HLA-G Protein, Human (HEK293, His)

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (HEK293, His) is the recombinant human-derived HLA-G protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (HEK293, His) is the recombinant human-derived HLA-G protein, expressed by HEK293 , with N-His labeled tag.

Background

HLA-G, a non-classical major histocompatibility class Ib molecule, plays a crucial role in immune regulation at the maternal-fetal interface. In association with B2M/beta-2 microglobulin, it forms a complex that selectively binds a limited repertoire of nonamer self-peptides derived from intracellular proteins, including histones and ribosomal proteins. This peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1, and LILRB2 receptors on uterine immune cells, fostering fetal development while maintaining maternal-fetal tolerance. Interactions with KIR2DL4 and LILRB1 receptors trigger NK cell senescence-associated secretory phenotype, promoting vascular remodeling and fetal growth during early pregnancy. Moreover, HLA-G's engagement with LILRB2 induces the differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, actively contributing to the maintenance of maternal-fetal tolerance. Additionally, HLA-G may play a role in balancing tolerance and antiviral immunity by modulating the effector functions of NK cells, CD8+ T cells, and B cells. Furthermore, it negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity, highlighting its multifaceted role in immune regulation at the maternal-fetal interface.

Species

Human

Source

HEK293

Tag

N-His

Accession

P17693-1 (G25-D338)

Gene ID
Molecular Construction
N-term
His
HLA-G (G25-D338)
Accession # P17693-1
C-term
Synonyms
B2 microglobulin; DADB-15K14.8; HLA 6.0; HLA class I histocompatibility antigen alpha chain G; Major histocompatibility complex class I G; MHC class I antigen; MHC class I antigen G; MHC G; T-cell A locus; TCA
AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Molecular Weight

Approximately 39.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HLA-G Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-G Protein, Human (HEK293, His)
Cat. No.:
HY-P71667
Quantity:
MCE Japan Authorized Agent: