HMGN3 Protein, Human (His)

HMGN3 binds to nucleosomes, regulates chromatin structure, and affects chromatin-dependent processes such as transcription and DNA repair. It affects insulin and glucagon levels and regulates pancreatic gene expression related to insulin secretion. HMGN3 Protein, Human (His) is the recombinant human-derived HMGN3 protein, expressed by E. coli , with N-His labeled tag. The total length of HMGN3 Protein, Human (His) is 77 a.a., with molecular weight of ~17 kDa.

HMGN3, a protein with the capability to bind to nucleosomes, exerts regulatory control over chromatin structure, thereby influencing various chromatin-dependent processes, including transcription, DNA replication, and DNA repair. It plays a role in the modulation of insulin and glucagon levels and participates in the regulation of pancreatic genes involved in insulin secretion. HMGN3 specifically binds to the promoter region of the glucose transporter SLC2A2, recruiting transcription factors such as PDX1, thereby impacting glucose homeostasis. Additionally, it regulates the expression of SLC6A9, a glycine transporter crucial for maintaining glycine concentration in synaptic junctions within the central nervous system. Beyond its metabolic functions, HMGN3 may also contribute to ocular development and astrocyte function. Furthermore, HMGN3 engages in interactions with the ligand binding domain of the thyroid receptor, requiring the presence of thyroid hormone for its activity, and interacts with the transcriptional regulator SEHBP, highlighting its multifaceted roles in cellular and physiological processes.

Human

E. coli

N-10*His

Q15651-2 (M1-N77)

9324  [NCBI]

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN

Approximately 17 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.