HNRNPA2B1 Protein, Mouse (His-SUMO, Myc)

The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag. The total length of HNRNPA2B1 Protein, Mouse (His-SUMO) is 353 a.a., with molecular weight of ~57.4 kDa.

HNRNPA2B1 Protein, a heterogeneous nuclear ribonucleoprotein (hnRNP), plays a pivotal role in RNA processing and transport. It associates with nascent pre-mRNAs, participating in the formation of hnRNP particles that condense and stabilize transcripts, minimizing tangling and knotting. This packaging process influences various cellular functions, including transcription, pre-mRNA processing, RNA nuclear export, subcellular localization, mRNA translation, and the stability of mature mRNAs. HNRNPA2B1 forms hnRNP particles with multiple hnRNPs and heterogeneous nuclear RNAs in the nucleus. Notably, in oligodendrocytes and neurons, it facilitates the transport of specific mRNAs to the cytoplasm by recognizing and binding A2RE or A2RE11 sequence motifs on select mRNAs. Beyond mRNA transport, HNRNPA2B1 also binds telomeric DNA sequences, protecting them from endonuclease digestion, and acts as a 'reader' of the N6-methyladenosine (m6A) mark on pri-miRNAs, promoting pri-miRNA processing and miRNA sorting into exosomes. Additionally, it serves as a regulator of mRNA splicing, impacting the splicing of genes like pyruvate kinase PKM. Furthermore, HNRNPA2B1 is implicated in the activation of the innate immune response, sensing viral DNA, and translocating to the cytoplasm to activate the TBK1-IRF3 pathway. These diverse functions highlight the versatility of HNRNPA2B1 in cellular processes.

Mouse

E. coli

N-10*His;N-SUMO;C-Myc

O88569 (M1-Y353)

53379  [NCBI]

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

Approximately 57.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS,6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.