HO-1 Protein, Human

HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free. The total length of HO-1 Protein, Human is 261 a.a., with molecular weight of ~30.0 kDa.

The HO-1 protein serves as a catalyst for the oxidative cleavage of heme at the alpha-methene bridge carbon, resulting in the release of carbon monoxide (CO) and the generation of biliverdin IXalpha, while concurrently releasing the central heme iron chelate as ferrous iron. This process has been extensively documented in various publications. Moreover, HO-1 protein plays a crucial role in safeguarding against programmed cell death by catabolizing free heme, thereby preventing its ability to sensitize cells and induce apoptosis. Numerous studies have affirmed the cytoprotective effect of HO-1 protein. Additionally, in the context of microbial infection, it has been observed that during SARS-CoV-2 infection, HO-1 protein promotes SARS-CoV-2 ORF3A-mediated autophagy, although it is not deemed necessary for the induction of reticulophagy by ORF3A.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

P09601 (M1-T261)

3162  [NCBI]

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT

Approximately 30.8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.