1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. HP-0175 Protein, Helicobacter pylori (GST)

HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 provides a link between helicobacter pylori-associated inflammation and gastric cancer by promoting the pro-inflammatory low-cytotoxic TIL response, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis. HP-0175 Protein, Helicobacter pylori (GST) is the recombinant HP-0175 protein, expressed by E. coli , with N-GST labeled tag. The total length of HP-0175 Protein, Helicobacter pylori (GST) is 278 a.a., with molecular weight of 58.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 provides a link between helicobacter pylori-associated inflammation and gastric cancer by promoting the pro-inflammatory low-cytotoxic TIL response, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis. HP-0175 Protein, Helicobacter pylori (GST) is the recombinant HP-0175 protein, expressed by E. coli , with N-GST labeled tag. The total length of HP-0175 Protein, Helicobacter pylori (GST) is 278 a.a., with molecular weight of 58.8 kDa.

Background

HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 is a peptidyl proline cis-trans isomerase that has a part-time effect on host cells. HP-0175 may provide a link between helicobacter pylori-associated inflammation and gastric cancer by promoting pro-inflammatory, low-cytotoxic TIL responses, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis[1][2][3].

Species

Others

Source

E. coli

Tag

N-GST

Accession

P56112 (K22-K299)

Gene ID

/

Molecular Construction
N-term
GST
HP-0175 (K22-K299)
Accession # P56112
C-term
Synonyms
Rotamase HP_0175; Putative peptidyl-prolyl cis-trans isomerase HP_0175
AA Sequence

KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK

Molecular Weight

58.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HP-0175 Protein, Helicobacter pylori (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HP-0175 Protein, Helicobacter pylori (GST)
Cat. No.:
HY-P700388
Quantity:
MCE Japan Authorized Agent: