HRAS Protein, Human (sf9, His)

HRAS Protein, a key player in initiating Ras protein signal transduction, facilitates the activation of Ras signaling cascades at the molecular level. Under HRAS influence, Ras proteins exhibit GDP/GTP binding and intrinsic GTPase activity, as confirmed by studies. These interactions underscore HRAS's integral role in orchestrating signal transduction dynamics, emphasizing its significance in cellular communication and regulation. HRAS Protein, Human (sf9, His) is the recombinant human-derived HRAS protein, expressed by Sf9 insect cells , with C-His labeled tag.

HRAS protein emerges as a key player in the initiation of Ras protein signal transduction, a pivotal process in cellular signaling. Operating at the molecular level, HRAS facilitates the activation of Ras signaling cascades. Ras proteins, under the influence of HRAS, demonstrate a capability to bind GDP/GTP and exhibit intrinsic GTPase activity, as substantiated by various studies. These molecular interactions underscore the integral role of HRAS in orchestrating the dynamics of signal transduction pathways, shedding light on its significance in cellular communication and regulation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

C-His

P01112-1 (M1-C186)

3265  [NCBI]

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Approximately 23 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 10% gly.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.