1. Recombinant Proteins
  2. Others
  3. HSP10/EPF Protein, Human (His)

HSP10/EPF Protein, Human (His)

Cat. No.: HY-P76283
SDS COA Handling Instructions

The HSP10/EPF protein is a cochaperone that plays a role in mitochondrial protein import and assembly. HSP10/EPF Protein, Human (His) is the recombinant human-derived HSP10/EPF protein, expressed by E. coli , with N-His, N-6*His labeled tag. The total length of HSP10/EPF Protein, Human (His) is 102 a.a., with molecular weight of ~13 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $55 In-stock
50 μg $150 In-stock
100 μg $260 In-stock
500 μg $720 In-stock
1 mg $1200 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE HSP10/EPF Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HSP10/EPF protein is a cochaperone that plays a role in mitochondrial protein import and assembly. HSP10/EPF Protein, Human (His) is the recombinant human-derived HSP10/EPF protein, expressed by E. coli , with N-His, N-6*His labeled tag. The total length of HSP10/EPF Protein, Human (His) is 102 a.a., with molecular weight of ~13 KDa.

Background

The HSP10/EPF protein functions as a co-chaperonin actively involved in mitochondrial protein import and macromolecular assembly. Collaborating with Hsp60, it facilitates the correct folding of imported proteins and, under stress conditions in the mitochondrial matrix, may prevent misfolding while promoting the refolding and proper assembly of unfolded polypeptides. The operational units of these chaperonins comprise heptameric rings of the large subunit Hsp60, forming a back-to-back double ring structure. In a cyclic process, Hsp60 ring complexes bind unfolded substrate proteins, followed by ATP binding and association with two heptameric rings of the co-chaperonin Hsp10. This leads to the sequestration of the substrate protein within the inner cavity of Hsp60, allowing for undisturbed folding. Synchronous ATP hydrolysis in all Hsp60 subunits results in the dissociation of the chaperonin rings, releasing ADP and the folded substrate protein. The HSP10/EPF protein forms a homoheptamer arranged in a ring structure and interacts with a Hsp60 tetradecamer to create the symmetrical football complex. These molecular interactions underscore the essential role of HSP10/EPF in orchestrating the folding and assembly of mitochondrial proteins.

Species

Human

Source

E. coli

Accession

P61604 (M1-D102)

Gene ID
Synonyms
10 kDa heat shock protein, mitochondrial; Hsp10; Chaperonin 10; CPN10; EPF; HSPE1
AA Sequence

MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Molecular Weight

Approximately 13 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HSP10/EPF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HSP10/EPF Protein, Human (His)
Cat. No.:
HY-P76283
Quantity:
MCE Japan Authorized Agent: