1. Recombinant Proteins
  2. Others
  3. HSP40/DNAJB1 Protein, Human (His)

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The HSP40/DNAJB1 protein plays a crucial role in cellular processes through its interactions with various partners. It interacts with HSP70, enhancing its ATPase activity and stimulating the association between HSC70 and HIP. Moreover, HSP40/DNAJB1 negatively regulates the transcriptional activity of HSF1 during the attenuation and recovery phase of the heat shock response, demonstrating its role in modulating heat shock-induced processes. Additionally, HSP40/DNAJB1 interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity during the recovery phase of the heat shock response. These interactions highlight the multifaceted nature of HSP40/DNAJB1 in orchestrating cellular responses to stress and protein folding, shedding light on its intricate regulatory functions.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P25685-1 (G2-I340)

Gene ID
Molecular Construction
N-term
HSP40 (G2-I340)
Accession # P25685-1
6*His
C-term
Synonyms
rHuDnaJ homolog subfamily B member 1/HSP40, His; DnaJ Homolog Subfamily B Member 1; DnaJ Protein Homolog 1; Heat Shock 40 kDa Protein 1; HSP40; Heat Shock Protein 40; Human DnaJ Protein 1; hDj-1; DNAJB1; DNAJ1; HDJ1; HSPF1
AA Sequence

GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Molecular Weight

41 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HSP40/DNAJB1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HSP40/DNAJB1 Protein, Human (His)
Cat. No.:
HY-P70331
Quantity:
MCE Japan Authorized Agent: