HSPB2 Protein, Human (His)

HSPB2 Protein potentially regulates the kinase DMPK, enhancing its activity and influencing cellular processes. The specific mechanisms and broader implications in cellular signaling pathways require elucidation. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades. HSPB2 Protein, Human (His) is the recombinant human-derived HSPB2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of HSPB2 Protein, Human (His) is 182 a.a., with molecular weight of ~22.0 kDa.

HSPB2 Protein emerges as a potential regulator, indicating its role in modulating the kinase DMPK. This interaction with DMPK suggests that HSPB2 may play a role in enhancing the kinase activity of DMPK, underscoring its potential influence on cellular processes governed by this kinase. The specific mechanisms through which HSPB2 regulates DMPK and the broader implications of this interaction in cellular signaling pathways remain to be fully elucidated. Comprehensive studies are essential to unravel the precise molecular pathways and functional significance of the HSPB2-DMPK interplay, shedding light on its potential contributions to cellular regulation and signaling cascades.

Human

E. coli

C-6*His

Q16082 (M1-P182)

3316  [NCBI]

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Approximately 22.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.