1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO)

Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO)

Cat. No.: HY-P71472
Handling Instructions Technical Support

The Hydrophobin-1/HFB1 protein plays a crucial role in enhancing surface hydrophobicity, which is an important factor in a variety of biological processes, including hyphal binding in reproductive structures, dispersal of aerial spores, and effects on the host Pathogenic responses to structural adhesion. Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO) is the recombinant Hydrophobin-1/HFB1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Hydrophobin-1/HFB1 protein plays a crucial role in enhancing surface hydrophobicity, which is an important factor in a variety of biological processes, including hyphal binding in reproductive structures, dispersal of aerial spores, and effects on the host Pathogenic responses to structural adhesion. Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO) is the recombinant Hydrophobin-1/HFB1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

Hydrophobin-1 (HFB1) is a protein that plays a crucial role in contributing to surface hydrophobicity, a characteristic vital for various biological processes. Its significance lies in facilitating the association of hyphae in reproductive structures, aiding in the dispersal of aerial spores, and promoting the adhesion of pathogens to host structures. As a homodimer, HFB1 likely forms a dimeric structure, which may enhance its effectiveness in providing hydrophobic properties to surfaces. The ability of HFB1 to influence surface hydrophobicity underscores its importance in the ecology and biology of fungi, impacting processes such as fungal growth, reproduction, and interactions with host organisms or surfaces.

Species

Others

Source

E. coli

Tag

N-His;N-SUMO

Accession

P52754 (S23-A97)

Gene ID

18488188  [NCBI]

Molecular Construction
N-term
6*His-SUMO
HFB1 (S23-A97)
Accession # P52754
C-term
Synonyms
hfb1; Hydrophobin-1; Hydrophobin I; HFBI
AA Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Molecular Weight

Approximately 23.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO)
Cat. No.:
HY-P71472
Quantity:
MCE Japan Authorized Agent: