Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO)

The Hydrophobin-1/HFB1 protein plays a crucial role in enhancing surface hydrophobicity, which is an important factor in a variety of biological processes, including hyphal binding in reproductive structures, dispersal of aerial spores, and effects on the host Pathogenic responses to structural adhesion. Hydrophobin-1/HFB1 Protein, Hypocrea jecorina (His-SUMO) is the recombinant Hydrophobin-1/HFB1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Hydrophobin-1 (HFB1) is a protein that plays a crucial role in contributing to surface hydrophobicity, a characteristic vital for various biological processes. Its significance lies in facilitating the association of hyphae in reproductive structures, aiding in the dispersal of aerial spores, and promoting the adhesion of pathogens to host structures. As a homodimer, HFB1 likely forms a dimeric structure, which may enhance its effectiveness in providing hydrophobic properties to surfaces. The ability of HFB1 to influence surface hydrophobicity underscores its importance in the ecology and biology of fungi, impacting processes such as fungal growth, reproduction, and interactions with host organisms or surfaces.

Others

E. coli

N-His;N-SUMO

P52754 (S23-A97)

18488188  [NCBI]

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Approximately 23.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.